PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00157.1_g00012.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 615aa    MW: 69577.8 Da    PI: 5.7655
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00157.1_g00012.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.4e-17356403148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
  Rsa1.0_00157.1_g00012.1 356 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLLRCSKSCRLRWTNYL 403
                              79******************************99************97 PP

2Myb_DNA-binding44.92.8e-14409454148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++T+ E+  ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
  Rsa1.0_00157.1_g00012.1 409 RGNFTPHEEGMIIHLQALLGNK-WASIASYLP-QRTDNDIKNYWNTHL 454
                              89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.60.40.3601.3E-323106IPR008962PapD-like
PROSITE profilePS5020226.3625114IPR000535Major sperm protein (MSP) domain
SuperFamilySSF493541.1E-335121IPR008962PapD-like
PfamPF006351.1E-286105IPR000535Major sperm protein (MSP) domain
PROSITE profilePS5129425.185351407IPR017930Myb domain
SuperFamilySSF466899.54E-30354450IPR009057Homeodomain-like
SMARTSM007172.4E-14355405IPR001005SANT/Myb domain
PfamPF002497.6E-16356403IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-22357410IPR009057Homeodomain-like
CDDcd001678.73E-11358403No hitNo description
PROSITE profilePS5129419.239408458IPR017930Myb domain
SMARTSM007174.2E-13408456IPR001005SANT/Myb domain
PfamPF002491.3E-12409454IPR001005SANT/Myb domain
CDDcd001679.90E-9411454No hitNo description
Gene3DG3DSA:1.10.10.602.8E-24411459IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MNMPLLDIQP RTLKFVVDLK KQSTCVVQLT NTTHLFVAFK VKTTSPKKYC VRPNVGVVAP  60
NSSCEFSVIM QAFKEPPPDM VCKDKFLIQS TAVPEETTDE DITASMRKLR VTLVMPSDSP  120
VLSPIKGTLK QEAVFEDSIL KDQSETLRPE YEREIVKEPR MVGDDELKPQ RKGVMDFIEN  180
DLKATKGAGY DTSKMANEAE SDPIRSRKDD DDLDAHTNMA MDLSGDQGFA NGKNSANSVT  240
YPEEPKMHRD RDVVQLQKTD AQNIRALDEY KLVKDIEEMK LKINALESKL KQADSTISKL  300
MEERSISSQN RESLQQELVE LRTKKIVKEV HIGFPLLFVC VVAFISVVIG SREIKKGPWT  360
PEEDIILVSY IQEHGPGNWR SVPTNTGLLR CSKSCRLRWT NYLRPGIKRG NFTPHEEGMI  420
IHLQALLGNK WASIASYLPQ RTDNDIKNYW NTHLKKKLNK SESEERSISE NITLQTSAAR  480
NTINHRSTYA SSTENISRLL EGWMRASPKS STANLLEQKL QNGSNDLMDH HNDQPPYEHV  540
EGSWDHGFHV HPKISEENVK CDLDVQEDGD GDGDGDDHHN ATPPLTFIEK WLLEETNTGG  600
QMEVMSPLME LSSML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-2435345824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1174691e-166AK117469.1 Arabidopsis thaliana At1g08810 mRNA for putative transcription factor, complete cds, clone: RAFL17-08-C21.
GenBankAY5195511e-166AY519551.1 Arabidopsis thaliana MYB transcription factor (At1g08810) mRNA, complete cds.
GenBankBT0050741e-166BT005074.1 Arabidopsis thaliana clone U50259 putative myb family transcription factor (At1g08810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013750897.10.0PREDICTED: vesicle-associated protein 2-2-like
RefseqXP_013750896.10.0PREDICTED: vesicle-associated protein 2-2-like
RefseqXP_013750895.10.0PREDICTED: vesicle-associated protein 2-2-like
SwissprotB9DHD71e-173VAP22_ARATH; Vesicle-associated protein 2-2
TrEMBLA0A078H2X10.0A0A078H2X1_BRANA; BnaCnng06450D protein
STRINGBra030744.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08810.11e-130myb domain protein 60